rawpixel
Edit Design
Blue palm leaf phone wallpaper, aesthetic botanical frame
Baifern
Save
Edit Design
wallpapermobile wallpaperiphone wallpaperframevintageleafdesignbotanical

Blue palm leaf phone wallpaper, aesthetic botanical frame

More
Premium image
This remix may contain elements from within the public domain
  • Low Resolution
    675 x 1200 px
  • High Resolution (HD)
    2250 x 4000 px | 300 dpi

View personal and business license

Get Premium from just
‎$8 / month

Explore Premium

Free

Free design resources and creative tools

0
Free forever
Join Free

Share

Set

Peacock jungle pattern iPhone wallpaper, pink aesthetic frame background
Peacock jungle pattern iPhone wallpaper, pink aesthetic frame background
https://www.rawpixel.com/image/8837383/image-wallpaper-background-iphoneView license
Colorful tropical plant phone wallpaper, vintage patterned frame
Colorful tropical plant phone wallpaper, vintage patterned frame
https://www.rawpixel.com/image/8836647/image-wallpaper-background-iphoneView license
Jaguar tiger patterned mobile wallpaper, wildlife frame background
Jaguar tiger patterned mobile wallpaper, wildlife frame background
https://www.rawpixel.com/image/8836658/image-wallpaper-background-iphoneView license
Pink palm leaf phone wallpaper, aesthetic botanical frame
Pink palm leaf phone wallpaper, aesthetic botanical frame
https://www.rawpixel.com/image/8836681/image-wallpaper-background-iphoneView license
Peacock jungle pattern iPhone wallpaper, blue aesthetic frame background
Peacock jungle pattern iPhone wallpaper, blue aesthetic frame background
https://www.rawpixel.com/image/8837435/image-wallpaper-background-iphoneView license
Jaguar tiger patterned mobile wallpaper, wildlife frame background
Jaguar tiger patterned mobile wallpaper, wildlife frame background
https://www.rawpixel.com/image/8836663/image-wallpaper-background-iphoneView license
Exotic butterfly patterned phone wallpaper, vintage botanical frame
Exotic butterfly patterned phone wallpaper, vintage botanical frame
https://www.rawpixel.com/image/8836675/image-wallpaper-background-iphoneView license
Colorful tropical plant phone wallpaper, vintage patterned frame
Colorful tropical plant phone wallpaper, vintage patterned frame
https://www.rawpixel.com/image/8836640/image-wallpaper-background-iphoneView license
Exotic butterfly patterned phone wallpaper, vintage botanical frame
Exotic butterfly patterned phone wallpaper, vintage botanical frame
https://www.rawpixel.com/image/8836669/image-wallpaper-background-iphoneView license
Blue palm leaf phone wallpaper, aesthetic botanical frame
Blue palm leaf phone wallpaper, aesthetic botanical frame
https://www.rawpixel.com/image/8836699/image-wallpaper-background-iphoneView license

Want to get in touch? We’d love to hear from you!

contact@rawpixel.com

join our Discord channel

  • ©2025 Rawpixel Ltd.
  • User Terms
  • Privacy Cookie Policy
  • Pricing
  • Licenses
  • FAQ
  • About
  • Affiliate Program
  • Charity Templates
  • Join us